Lineage for d6apsa1 (6aps A:1-202)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2891301Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2891302Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2891303Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)
  6. 2891394Protein Hypoxanthine PRTase [53286] (4 species)
  7. 2891405Species Trypanosoma brucei [TaxId:5702] [324926] (10 PDB entries)
  8. 2891408Domain d6apsa1: 6aps A:1-202 [349475]
    Other proteins in same PDB: d6apsa2
    automated match to d1p17b_
    complexed with mg, peg, so4, sv2, trs

Details for d6apsa1

PDB Entry: 6aps (more details), 1.76 Å

PDB Description: trypanosoma brucei hypoxanthine guanine phosphoribosyltransferase in complex with [(2-((guanine-9h-yl)methyl)propane-1,3 diyl)bis(oxy) ]bis(methylene))diphosphonic acid
PDB Compounds: (A:) hypoxanthine-guanine phosphoribosyltransferase

SCOPe Domain Sequences for d6apsa1:

Sequence, based on SEQRES records: (download)

>d6apsa1 c.61.1.1 (A:1-202) Hypoxanthine PRTase {Trypanosoma brucei [TaxId: 5702]}
mepackydfatsvlfteaelhtrmrgvaqriaddysncnlkplenplvivsvlkgsfvft
admvrilgdfgvptrveflrassyghdtkscgrvdvkadglcdirgkhvlvledildtal
tlrevvdslkksepasiktlvaidkpggrkipftaeyvvadvpnvfvvgygldydqsyre
vrdvvilkpsvyetwgkelerr

Sequence, based on observed residues (ATOM records): (download)

>d6apsa1 c.61.1.1 (A:1-202) Hypoxanthine PRTase {Trypanosoma brucei [TaxId: 5702]}
mepackydfatsvlfteaelhtrmrgvaqriaddysncnlkplenplvivsvlkgsfvft
admvrilgdfgvptrveflrlcdirgkhvlvledildtaltlrevvdslkksepasiktl
vaidkpggrkipftaeyvvadvpnvfvvgygldydqsyrevrdvvilkpsvyetwgkele
rr

SCOPe Domain Coordinates for d6apsa1:

Click to download the PDB-style file with coordinates for d6apsa1.
(The format of our PDB-style files is described here.)

Timeline for d6apsa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6apsa2
View in 3D
Domains from other chains:
(mouse over for more information)
d6apsb_