Lineage for d1ekkb_ (1ekk B:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 492652Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 492653Superfamily c.72.1: Ribokinase-like [53613] (5 families) (S)
    has extra strand located between strands 2 and 3
  5. 492708Family c.72.1.2: Thiamin biosynthesis kinases [53620] (2 proteins)
  6. 492717Protein Hydroxyethylthiazole kinase (THZ kinase, ThiK) [53621] (2 species)
  7. 492720Species Bacillus subtilis [TaxId:1423] [53622] (5 PDB entries)
  8. 492722Domain d1ekkb_: 1ekk B: [34947]

Details for d1ekkb_

PDB Entry: 1ekk (more details), 2 Å

PDB Description: crystal structure of hydroxyethylthiazole kinase in the r3 form with hydroxyethylthiazole

SCOP Domain Sequences for d1ekkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ekkb_ c.72.1.2 (B:) Hydroxyethylthiazole kinase (THZ kinase, ThiK) {Bacillus subtilis}
mdaqsaakcltavrrhsplvhsitnnvvtnftangllalgaspvmayakeevadmakiag
alvlnigtlskesveamiiagksanehgvpvildpvgagatpfrtesardiirevrlaai
rgnaaeiahtvgvtdwlikgvdagegggdiirlaqqaaqklntviaitgevdviadtshv
ytlhnghklltkvtgagclltsvvgafcaveenplfaaiaaissygvaaqlaaqqtadkg
pgsfqiellnklstvteqdvqewatierv

SCOP Domain Coordinates for d1ekkb_:

Click to download the PDB-style file with coordinates for d1ekkb_.
(The format of our PDB-style files is described here.)

Timeline for d1ekkb_: