Lineage for d6b6ga_ (6b6g A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2896011Family c.67.1.4: GABA-aminotransferase-like [53417] (17 proteins)
    formerly omega-Aminoacid:pyruvate aminotransferase-like
  6. 2896032Protein 4-aminobutyrate aminotransferase, GABA-aminotransferase [53424] (2 species)
  7. 2896054Species Pig (Sus scrofa) [TaxId:9823] [53425] (9 PDB entries)
  8. 2896079Domain d6b6ga_: 6b6g A: [349467]
    automated match to d4y0ha_
    complexed with act, fes, gol, rmt

Details for d6b6ga_

PDB Entry: 6b6g (more details), 1.95 Å

PDB Description: crystal structure of gaba aminotransferase bound to (s)-3-amino-4- (difluoromethylenyl)cyclopent-1-ene-1-carboxylic acid, an potent inactivatorfor the treatment of addiction
PDB Compounds: (A:) 4-aminobutyrate aminotransferase, mitochondrial

SCOPe Domain Sequences for d6b6ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6b6ga_ c.67.1.4 (A:) 4-aminobutyrate aminotransferase, GABA-aminotransferase {Pig (Sus scrofa) [TaxId: 9823]}
fdydgplmktevpgprsrelmkqlniiqnaeavhffcnyeesrgnylvdvdgnrmldlys
qissipigyshpalvklvqqpqnvstfinrpalgilppenfveklresllsvapkgmsql
itmacgscsnenafktifmwyrskergesafskeeletcminqapgcpdysilsfmgafh
grtmgclatthskaihkidipsfdwpiapfprlkypleefvkenqqeearcleevedliv
kyrkkkktvagiivepiqseggdnhasddffrklrdisrkhgcaflvdevqtgggstgkf
wahehwglddpadvmtfskkmmtggffhkeefrpnapyrifntwlgdpsknlllaevini
ikredllsnaahagkvlltglldlqarypqfisrvrgrgtfcsfdtpdesirnklisiar
nkgvmlggcgdksirfrptlvfrdhhahlflnifsdiladf

SCOPe Domain Coordinates for d6b6ga_:

Click to download the PDB-style file with coordinates for d6b6ga_.
(The format of our PDB-style files is described here.)

Timeline for d6b6ga_: