Lineage for d1ekka_ (1ekk A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 27104Fold c.72: Ribokinase-like [53612] (2 superfamilies)
  4. 27105Superfamily c.72.1: Ribokinase-like [53613] (2 families) (S)
  5. 27125Family c.72.1.2: Hydroxyethylthiazole kinase (thz kinase) [53620] (1 protein)
  6. 27126Protein Hydroxyethylthiazole kinase (thz kinase) [53621] (1 species)
  7. 27127Species Bacillus subtilis [TaxId:1423] [53622] (5 PDB entries)
  8. 27133Domain d1ekka_: 1ekk A: [34946]

Details for d1ekka_

PDB Entry: 1ekk (more details), 2 Å

PDB Description: crystal structure of hydroxyethylthiazole kinase in the r3 form with hydroxyethylthiazole

SCOP Domain Sequences for d1ekka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ekka_ c.72.1.2 (A:) Hydroxyethylthiazole kinase (thz kinase) {Bacillus subtilis}
mdaqsaakcltavrrhsplvhsitnnvvtnftangllalgaspvmayakeevadmakiag
alvlnigtlskesveamiiagksanehgvpvildpvgagatpfrtesardiirevrlaai
rgnaaeiahtvgvtdwlikgvdagegggdiirlaqqaaqklntviaitgevdviadtshv
ytlhnghklltkvtgagclltsvvgafcaveenplfaaiaaissygvaaqlaaqqtadkg
pgsfqiellnklstvteqdvqewatierv

SCOP Domain Coordinates for d1ekka_:

Click to download the PDB-style file with coordinates for d1ekka_.
(The format of our PDB-style files is described here.)

Timeline for d1ekka_: