Lineage for d6aptb_ (6apt B:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)
  6. Protein Hypoxanthine PRTase [53286] (4 species)
  7. Species Trypanosoma brucei [TaxId:5702] [324926] (10 PDB entries)
  8. Domain d6aptb_: 6apt B: [349459]
    automated match to d1p17b_
    complexed with 45t, peg

Details for d6aptb_

PDB Entry: 6apt (more details), 1.8 Å

PDB Description: trypanosoma brucei hypoxanthine guanine phosphoribosyltransferase in complex with {[(2s)-3-(2-amino-6-oxo-1,6-dihydro-9h-purin-9-yl) propane-1,2-diyl]bis(oxyethane-2,1-diyl)}bis(phosphonic acid)
PDB Compounds: (B:) hypoxanthine-guanine phosphoribosyltransferase

SCOPe Domain Sequences for d6aptb_:

Sequence, based on SEQRES records: (download)

>d6aptb_ c.61.1.1 (B:) Hypoxanthine PRTase {Trypanosoma brucei [TaxId: 5702]}
ckydfatsvlfteaelhtrmrgvaqriaddysncnlkplenplvivsvlkgsfvftadmv
rilgdfgvptrveflrassyghdtkscgrvdvkadglcdirgkhvlvledildtaltlre
vvdslkksepasiktlvaidkpggrkipftaeyvvadvpnvfvvgygldydqsyrevrdv
vilkpsvyetwgk

Sequence, based on observed residues (ATOM records): (download)

>d6aptb_ c.61.1.1 (B:) Hypoxanthine PRTase {Trypanosoma brucei [TaxId: 5702]}
ckydfatsvlfteaelhtrmrgvaqriaddysncnlkplenplvivsvlkgsfvftadmv
rilgdfgvptrveflrirgkhvlvledildtaltlrevvdslkksepasiktlvaidkpg
grkipftaeyvvadvpnvfvvgygldydqsyrevrdvvilkpsvyetwgk

SCOPe Domain Coordinates for d6aptb_ are not available.

Timeline for d6aptb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d6apta_