Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.82: ALDH-like [53719] (1 superfamily) consists of two similar domains with 3 layers (a/b/a) each; duplication core: parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.82.1: ALDH-like [53720] (3 families) binds NAD differently from other NAD(P)-dependent oxidoreductases |
Family c.82.1.1: ALDH-like [53721] (6 proteins) |
Protein automated matches [190401] (5 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [189906] (28 PDB entries) |
Domain d6b5hb_: 6b5h B: [349456] automated match to d3n80a_ complexed with cu4, nad |
PDB Entry: 6b5h (more details), 2.3 Å
SCOPe Domain Sequences for d6b5hb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6b5hb_ c.82.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} psptpnleikytkifinnewqnsesgrvfpvynpatgeqvcevqeadkadidkavqaarl afslgsvwrrmdasergrlldkladlverdravlatmeslnggkpflqafyvdlqgvikt fryyagwadkihgmtipvdgdyftftrhepigvcgqiipwnfpllmfawkiapalccgnt vvikpaeqtplsalymgalikeagfppgvinilpgygptagaaiashigidkiaftgste vgkliqeaagrsnlkrvtlelggkspniifadadldyaveqahqgvffnqgqcctagsri fveesiyeefvrrsverakrrvvgspfdptteqgpqidkkqynkileliqsgvaegakle cggkglgrkgffieptvfsnvtddmriakeeifgpvqeilrfktmdevierannsdfglv aavftndinkaltvssamqagtvwincynalnaqspfggfkmsgngremgefglreysev ktvtvkipqkns
Timeline for d6b5hb_: