![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.218: YgfY-like [109909] (1 superfamily) 5 helices; array; forms a tight dimer in crystals |
![]() | Superfamily a.218.1: YgfY-like [109910] (2 families) ![]() |
![]() | Family a.218.1.0: automated matches [254244] (1 protein) not a true family |
![]() | Protein automated matches [254560] (3 species) not a true protein |
![]() | Species Escherichia coli [TaxId:562] [267765] (3 PDB entries) |
![]() | Domain d6b58d_: 6b58 D: [349455] automated match to d1x6ib_ complexed with act, edo, fad, gol, k, mli, peg |
PDB Entry: 6b58 (more details), 2.61 Å
SCOPe Domain Sequences for d6b58d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6b58d_ a.218.1.0 (D:) automated matches {Escherichia coli [TaxId: 562]} afihwacrrgmreldisimpffeheydslsddekrifirllecddpdlfnwlmnhgkpad aelemmvrliqtrnrerg
Timeline for d6b58d_: