Lineage for d6b7fb_ (6b7f B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2860045Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2860373Family c.26.1.3: Adenylyltransferase [52397] (6 proteins)
  6. 2860491Protein Phosphopantetheine adenylyltransferase [52398] (7 species)
  7. 2860512Species Escherichia coli [TaxId:83333] [350064] (18 PDB entries)
  8. 2860545Domain d6b7fb_: 6b7f B: [349454]
    Other proteins in same PDB: d6b7fa2
    automated match to d1gn8a_
    complexed with cw4, dms, k, pop, so4, trs

Details for d6b7fb_

PDB Entry: 6b7f (more details), 2.56 Å

PDB Description: crystal structure of e.coli phosphopantetheine adenylyltransferase (ppat/coad) in complex with (r)-3,3-dimethyl-4-(5-vinyl-1h-imidazol- 1-yl)isochroman-1-one
PDB Compounds: (B:) phosphopantetheine adenylyltransferase

SCOPe Domain Sequences for d6b7fb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6b7fb_ c.26.1.3 (B:) Phosphopantetheine adenylyltransferase {Escherichia coli [TaxId: 83333]}
kraiypgtfdpitnghidivtratqmfdhvilaiaaspskkpmftleervalaqqatahl
gnvevvgfsdlmanfarnqhatvlirglravadfeyemqlahmnrhlmpelesvflmpsk
ewsfissslvkevarhqgdvthflpenvhqalmakla

SCOPe Domain Coordinates for d6b7fb_:

Click to download the PDB-style file with coordinates for d6b7fb_.
(The format of our PDB-style files is described here.)

Timeline for d6b7fb_: