Lineage for d1esjc1 (1esj C:1-272)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1872415Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 1872416Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 1872512Family c.72.1.2: Thiamin biosynthesis kinases [53620] (2 proteins)
  6. 1872521Protein Hydroxyethylthiazole kinase (THZ kinase, ThiK) [53621] (2 species)
  7. 1872522Species Bacillus subtilis [TaxId:1423] [53622] (5 PDB entries)
  8. 1872527Domain d1esjc1: 1esj C:1-272 [34945]
    complexed with so4; mutant

Details for d1esjc1

PDB Entry: 1esj (more details), 1.8 Å

PDB Description: crystal structure of thiazole kinase mutant (c198s)
PDB Compounds: (C:) hydroxyethylthiazole kinase

SCOPe Domain Sequences for d1esjc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1esjc1 c.72.1.2 (C:1-272) Hydroxyethylthiazole kinase (THZ kinase, ThiK) {Bacillus subtilis [TaxId: 1423]}
mdaqsaakcltavrrhsplvhsitnnvvtnftangllalgaspvmayakeevadmakiag
alvlnigtlskesveamiiagksanehgvpvildpvgagatpfrtesardiirevrlaai
rgnaaeiahtvgvtdwlikgvdagegggdiirlaqqaaqklntviaitgevdviadtshv
ytlhnghklltkvtgagslltsvvgafcaveenplfaaiaaissygvaaqlaaqqtadkg
pgsfqiellnklstvteqdvqewatiervtvs

SCOPe Domain Coordinates for d1esjc1:

Click to download the PDB-style file with coordinates for d1esjc1.
(The format of our PDB-style files is described here.)

Timeline for d1esjc1: