Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
Fold c.72: Ribokinase-like [53612] (3 superfamilies) core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest potential superfamily: members of this fold have similar functions but different ATP-binding sites |
Superfamily c.72.1: Ribokinase-like [53613] (5 families) has extra strand located between strands 2 and 3 |
Family c.72.1.2: Thiamin biosynthesis kinases [53620] (2 proteins) |
Protein Hydroxyethylthiazole kinase (THZ kinase, ThiK) [53621] (2 species) |
Species Bacillus subtilis [TaxId:1423] [53622] (5 PDB entries) |
Domain d1esjb1: 1esj B:1-272 [34944] |
PDB Entry: 1esj (more details), 1.8 Å
SCOP Domain Sequences for d1esjb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1esjb1 c.72.1.2 (B:1-272) Hydroxyethylthiazole kinase (THZ kinase, ThiK) {Bacillus subtilis} mdaqsaakcltavrrhsplvhsitnnvvtnftangllalgaspvmayakeevadmakiag alvlnigtlskesveamiiagksanehgvpvildpvgagatpfrtesardiirevrlaai rgnaaeiahtvgvtdwlikgvdagegggdiirlaqqaaqklntviaitgevdviadtshv ytlhnghklltkvtgagslltsvvgafcaveenplfaaiaaissygvaaqlaaqqtadkg pgsfqiellnklstvteqdvqewatiervtvs
Timeline for d1esjb1: