SCOPe 2.08: Domain d6at6a1: 6at6 A:11-128

Lineage for d6at6a1 (6at6 A:11-128)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d6at6a1: 6at6 A:11-128 [349432]
   Other proteins in same PDB: d6at6a2, d6at6b2
   automated match to d1ogad1

Details for d6at6a1

PDB Entry: 6at6, 1.42 Å

PDB Description: crystal structure of the kfj5 tcr

PDB Compounds: (A:) T-cell receptor alpha variable 4, T-cell receptor, sp3.4 alpha chain chimera

SCOPe Domain Sequences for d6at6a1:

Sequence; same for both SEQRES and ATOM records:

>d6at6a1 b.1.1.0 (A:11-128) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lakttqpismdsyegqevnitcshnniatndyitwyqqfpsqgprfiiqgyktkvtneva
slfipadrksstlslprvslsdtavyyclvgeildnfnkfyfgsgtklnvkpniqnpd

Timeline for d6at6a1:

• d6at6a1 first appeared in SCOPe 2.07