SCOPe 2.07: Domain d6b7da1: 6b7d A:1-159

Lineage for d6b7da1 (6b7d A:1-159)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.3: Adenylyltransferase [52397] (6 proteins)

6. Protein automated matches [190964] (7 species)
   not a true protein

7. Species Escherichia coli [TaxId:83333] [317802] (7 PDB entries)

8. Domain d6b7da1: 6b7d A:1-159 [349430]
   Other proteins in same PDB: d6b7da2
   automated match to d1gn8a_
   complexed with cwg, dms, k, so4

Details for d6b7da1

PDB Entry: 6b7d, 1.8 Å

PDB Description: crystal structure of e.coli phosphopantetheine adenylyltransferase (ppat/coad) in complex with 3-(4-chlorophenyl)-6-methoxy-4,5- dimethylpyridazine

PDB Compounds: (A:) phosphopantetheine adenylyltransferase

SCOPe Domain Sequences for d6b7da1:

Sequence, based on SEQRES records:

>d6b7da1 c.26.1.3 (A:1-159) automated matches {Escherichia coli [TaxId: 83333]}
mqkraiypgtfdpitnghidivtratqmfdhvilaiaaspskkpmftleervalaqqata
hlgnvevvgfsdlmanfarnqhatvlirglravadfeyemqlahmnrhlmpelesvflmp
skewsfissslvkevarhqgdvthflpenvhqalmakla

Sequence, based on observed residues (ATOM records):

>d6b7da1 c.26.1.3 (A:1-159) automated matches {Escherichia coli [TaxId: 83333]}
mqkraiypgtfdpitnghidivtratqmfdhvilaiaasppmftleervalaqqatahlg
nvevvgfsdlmanfarnqhatvlirglravadfeyemqlahmnrhlmpelesvflmpske
wsfissslvkevarhqgdvthflpenvhqalmakla

Timeline for d6b7da1:

• d6b7da1 is new in SCOPe 2.07-stable
  
• d6b7da1 appears in the current release, SCOPe 2.08