Lineage for d6b7da1 (6b7d A:1-159)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2860045Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2860373Family c.26.1.3: Adenylyltransferase [52397] (6 proteins)
  6. 2860491Protein Phosphopantetheine adenylyltransferase [52398] (7 species)
  7. 2860512Species Escherichia coli [TaxId:83333] [350064] (18 PDB entries)
  8. 2860521Domain d6b7da1: 6b7d A:1-159 [349430]
    Other proteins in same PDB: d6b7da2
    automated match to d1gn8a_
    complexed with cwg, dms, k, so4

Details for d6b7da1

PDB Entry: 6b7d (more details), 1.8 Å

PDB Description: crystal structure of e.coli phosphopantetheine adenylyltransferase (ppat/coad) in complex with 3-(4-chlorophenyl)-6-methoxy-4,5- dimethylpyridazine
PDB Compounds: (A:) phosphopantetheine adenylyltransferase

SCOPe Domain Sequences for d6b7da1:

Sequence, based on SEQRES records: (download)

>d6b7da1 c.26.1.3 (A:1-159) Phosphopantetheine adenylyltransferase {Escherichia coli [TaxId: 83333]}
mqkraiypgtfdpitnghidivtratqmfdhvilaiaaspskkpmftleervalaqqata
hlgnvevvgfsdlmanfarnqhatvlirglravadfeyemqlahmnrhlmpelesvflmp
skewsfissslvkevarhqgdvthflpenvhqalmakla

Sequence, based on observed residues (ATOM records): (download)

>d6b7da1 c.26.1.3 (A:1-159) Phosphopantetheine adenylyltransferase {Escherichia coli [TaxId: 83333]}
mqkraiypgtfdpitnghidivtratqmfdhvilaiaasppmftleervalaqqatahlg
nvevvgfsdlmanfarnqhatvlirglravadfeyemqlahmnrhlmpelesvflmpske
wsfissslvkevarhqgdvthflpenvhqalmakla

SCOPe Domain Coordinates for d6b7da1:

Click to download the PDB-style file with coordinates for d6b7da1.
(The format of our PDB-style files is described here.)

Timeline for d6b7da1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6b7da2
View in 3D
Domains from other chains:
(mouse over for more information)
d6b7db_