SCOP 1.71: Domain d1esja1: 1esj A:1-272

Lineage for d1esja1 (1esj A:1-272)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.72: Ribokinase-like [53612] (3 superfamilies)
   core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
   potential superfamily: members of this fold have similar functions but different ATP-binding sites

4. Superfamily c.72.1: Ribokinase-like [53613] (5 families)
   has extra strand located between strands 2 and 3

5. Family c.72.1.2: Thiamin biosynthesis kinases [53620] (2 proteins)

6. Protein Hydroxyethylthiazole kinase (THZ kinase, ThiK) [53621] (2 species)

7. Species Bacillus subtilis [TaxId:1423] [53622] (5 PDB entries)

8. Domain d1esja1: 1esj A:1-272 [34943]

Details for d1esja1

PDB Entry: 1esj, 1.8 Å

PDB Description: crystal structure of thiazole kinase mutant (c198s)

SCOP Domain Sequences for d1esja1:

Sequence; same for both SEQRES and ATOM records:

>d1esja1 c.72.1.2 (A:1-272) Hydroxyethylthiazole kinase (THZ kinase, ThiK) {Bacillus subtilis}
mdaqsaakcltavrrhsplvhsitnnvvtnftangllalgaspvmayakeevadmakiag
alvlnigtlskesveamiiagksanehgvpvildpvgagatpfrtesardiirevrlaai
rgnaaeiahtvgvtdwlikgvdagegggdiirlaqqaaqklntviaitgevdviadtshv
ytlhnghklltkvtgagslltsvvgafcaveenplfaaiaaissygvaaqlaaqqtadkg
pgsfqiellnklstvteqdvqewatiervtvs

Timeline for d1esja1:

• d1esja1 first appeared (with stable ids) in SCOP 1.55
  
• d1esja1 appears in SCOP 1.69
  
• d1esja1 appears in SCOP 1.73
  
• d1esja1 appears in the current release, SCOPe 2.08