Lineage for d6b1mb2 (6b1m B:189-381)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2460924Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2460925Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2460926Family c.55.1.1: Actin/HSP70 [53068] (8 protein domains)
  6. 2461320Protein automated matches [226905] (13 species)
    not a true protein
  7. 2461376Species Human (Homo sapiens) [TaxId:9606] [225574] (49 PDB entries)
  8. 3049349Domain d6b1mb2: 6b1m B:189-381 [349411]
    Other proteins in same PDB: d6b1ma3, d6b1mb3
    automated match to d1atra2
    complexed with anp, gol, mg; mutant

Details for d6b1mb2

PDB Entry: 6b1m (more details), 1.9 Å

PDB Description: disrupted hydrogen bond network impairs atpase activity in an hsc70 cysteine mutant
PDB Compounds: (B:) Heat shock protein family A (Hsp70) member 8

SCOPe Domain Sequences for d6b1mb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6b1mb2 c.55.1.1 (B:189-381) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vgaernvlifdlgggtfdvsiltiedgifevkstagdthlggedfdnrmvnhfiaefkrk
hkkdisenkravrrlrtacerakrtlssstqasieidslyegidfytsitrarfeelnad
lfrgtldpvekalrdakldksqihdivlvggstripkiqkllqdffngkelnksinpdea
vaygaavqaails

SCOPe Domain Coordinates for d6b1mb2:

Click to download the PDB-style file with coordinates for d6b1mb2.
(The format of our PDB-style files is described here.)

Timeline for d6b1mb2:

  • d6b1mb2 appears in periodic updates to SCOPe 2.07 starting on 2018-04-07