Lineage for d1ekqa_ (1ekq A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 27104Fold c.72: Ribokinase-like [53612] (2 superfamilies)
  4. 27105Superfamily c.72.1: Ribokinase-like [53613] (2 families) (S)
  5. 27125Family c.72.1.2: Hydroxyethylthiazole kinase (thz kinase) [53620] (1 protein)
  6. 27126Protein Hydroxyethylthiazole kinase (thz kinase) [53621] (1 species)
  7. 27127Species Bacillus subtilis [TaxId:1423] [53622] (5 PDB entries)
  8. 27128Domain d1ekqa_: 1ekq A: [34941]

Details for d1ekqa_

PDB Entry: 1ekq (more details), 1.5 Å

PDB Description: crystal structure of hydroxyethylthiazole kinase in r3 space group

SCOP Domain Sequences for d1ekqa_:

Sequence, based on SEQRES records: (download)

>d1ekqa_ c.72.1.2 (A:) Hydroxyethylthiazole kinase (thz kinase) {Bacillus subtilis}
mdaqsaakcltavrrhsplvhsitnnvvtnftangllalgaspvmayakeevadmakiag
alvlnigtlskesveamiiagksanehgvpvildpvgagatpfrtesardiirevrlaai
rgnaaeiahtvgvtdwlikgvdagegggdiirlaqqaaqklntviaitgevdviadtshv
ytlhnghklltkvtgagclltsvvgafcaveenplfaaiaaissygvaaqlaaqqtadkg
pgsfqiellnklstvteqdvqewatierv

Sequence, based on observed residues (ATOM records): (download)

>d1ekqa_ c.72.1.2 (A:) Hydroxyethylthiazole kinase (thz kinase) {Bacillus subtilis}
mdaqsaakcltavrrhsplvhsitnnvvtnftangllalgaspvmayakeevadmakiag
alvlnigtlskesveamiiagksanehgvpvildpvgagatpfrtesardiirevrlaai
rgnaaeiahtvggdiirlaqqaaqklntviaitgevdviadtshvytlhnghklltkvtg
agclltsvvgafcaveenplfaaiaaissygvaaqlaaqqtadkgpgsfqiellnklstv
teqdvqewatierv

SCOP Domain Coordinates for d1ekqa_:

Click to download the PDB-style file with coordinates for d1ekqa_.
(The format of our PDB-style files is described here.)

Timeline for d1ekqa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ekqb_