Lineage for d6b2pa_ (6b2p A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2979693Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2982491Protein Mycobacterial protein kinase PknB, catalytic domain [82793] (1 species)
    OPK group; PKN subfamily; serine/threonine kinase
  7. 2982492Species Mycobacterium tuberculosis [TaxId:1773] [82794] (4 PDB entries)
  8. 2982498Domain d6b2pa_: 6b2p A: [349396]
    automated match to d1mrub_
    complexed with cjj

Details for d6b2pa_

PDB Entry: 6b2p (more details), 3.01 Å

PDB Description: dual inhibition of the essential protein kinases a and b in mycobacterium tuberculosis
PDB Compounds: (A:) serine/threonine-protein kinase pknb

SCOPe Domain Sequences for d6b2pa_:

Sequence, based on SEQRES records: (download)

>d6b2pa_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]}
pshlsdryelgeilgfggmsevhlardlrlhrdvavkvlradlardpsfylrfrreaqna
aalnhpaivavydtgeaetpagplpyivmeyvdgvtlrdivhtegpmtpkraieviadac
qalnfshqngiihrdvkpanimisatnavkvmdfgiaraiadsgnsvtqtaavigtaqyl
speqargdsvdarsdvyslgcvlyevltgeppftgdspvsvayqhvredpippsarhegl
sadldavvlkalaknpenryqtaaemradlvrvhn

Sequence, based on observed residues (ATOM records): (download)

>d6b2pa_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]}
pshlsdryelgeilgfggmsevhlardlrlhrdvavkvlradlardpsfylrfrreaqna
aalnhpaivavydtgeaetpagplpyivmeyvdgvtlrdivhtegpmtpkraieviadac
qalnfshqngiihrdvkpanimisatnavkvmdfgtaqylspeqargdsvdarsdvyslg
cvlyevltgeppftgdspvsvayqhvredpippsarheglsadldavvlkalaknpenry
qtaaemradlvrvhn

SCOPe Domain Coordinates for d6b2pa_:

Click to download the PDB-style file with coordinates for d6b2pa_.
(The format of our PDB-style files is described here.)

Timeline for d6b2pa_: