SCOPe 2.08: Domain d6b58b_: 6b58 B:

Lineage for d6b58b_ (6b58 B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.218: YgfY-like [109909] (1 superfamily)
   5 helices; array; forms a tight dimer in crystals

4. Superfamily a.218.1: YgfY-like [109910] (2 families)

5. Family a.218.1.0: automated matches [254244] (1 protein)
   not a true family

6. Protein automated matches [254560] (3 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [267765] (3 PDB entries)

8. Domain d6b58b_: 6b58 B: [349381]
   automated match to d1x6ib_
   complexed with act, edo, fad, gol, k, mli, peg

Details for d6b58b_

PDB Entry: 6b58, 2.61 Å

PDB Description: frda-sdhe assembly intermediate

PDB Compounds: (B:) FAD assembly factor SdhE

SCOPe Domain Sequences for d6b58b_:

Sequence; same for both SEQRES and ATOM records:

>d6b58b_ a.218.1.0 (B:) automated matches {Escherichia coli [TaxId: 562]}
kafihwacrrgmreldisimpffeheydslsddekrifirllecddpdlfnwlmnhgkpa
daelemmvrliqtrnrerg

Timeline for d6b58b_:

• d6b58b_ first appeared in SCOPe 2.07