Lineage for d6b58b_ (6b58 B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2737726Fold a.218: YgfY-like [109909] (1 superfamily)
    5 helices; array; forms a tight dimer in crystals
  4. 2737727Superfamily a.218.1: YgfY-like [109910] (2 families) (S)
  5. 2737732Family a.218.1.0: automated matches [254244] (1 protein)
    not a true family
  6. 2737733Protein automated matches [254560] (3 species)
    not a true protein
  7. 2737734Species Escherichia coli [TaxId:562] [267765] (3 PDB entries)
  8. 2737738Domain d6b58b_: 6b58 B: [349381]
    automated match to d1x6ib_
    complexed with act, edo, fad, gol, k, mli, peg

Details for d6b58b_

PDB Entry: 6b58 (more details), 2.61 Å

PDB Description: frda-sdhe assembly intermediate
PDB Compounds: (B:) FAD assembly factor SdhE

SCOPe Domain Sequences for d6b58b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6b58b_ a.218.1.0 (B:) automated matches {Escherichia coli [TaxId: 562]}
kafihwacrrgmreldisimpffeheydslsddekrifirllecddpdlfnwlmnhgkpa
daelemmvrliqtrnrerg

SCOPe Domain Coordinates for d6b58b_:

Click to download the PDB-style file with coordinates for d6b58b_.
(The format of our PDB-style files is described here.)

Timeline for d6b58b_: