SCOPe 2.08: Domain d6az2e1: 6az2 E:3-109

Lineage for d6az2e1 (6az2 E:3-109)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d6az2e1: 6az2 E:3-109 [349373]
   Other proteins in same PDB: d6az2a_, d6az2b_, d6az2c_, d6az2d1, d6az2d2, d6az2e2, d6az2f2
   automated match to d3pgfl1

Details for d6az2e1

PDB Entry: 6az2, 2.48 Å

PDB Description: crystal structure of asf1-fab 12e complex

PDB Compounds: (E:) Fab light chain

SCOPe Domain Sequences for d6az2e1:

Sequence; same for both SEQRES and ATOM records:

>d6az2e1 b.1.1.0 (E:3-109) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspsslsasvgdrvtitcrasqsvssavawyqqkpgkapklliysasslysgvps
rfsgsrsgtdftltisslqpedfatyycqqsqwypitfgqgtkveik

Timeline for d6az2e1:

• d6az2e1 first appeared in SCOPe 2.07