SCOPe 2.08: Domain d6aoxa_: 6aox A:

Lineage for d6aoxa_ (6aox A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.3: Bacterial adhesins [49401] (7 families)

5. Family b.2.3.0: automated matches [191391] (1 protein)
   not a true family

6. Protein automated matches [190503] (10 species)
   not a true protein

7. Species Escherichia coli [TaxId:364106] [349115] (10 PDB entries)

8. Domain d6aoxa_: 6aox A: [349370]
   automated match to d4xocb_
   complexed with a2g, gal

Details for d6aoxa_

PDB Entry: 6aox, 2.1 Å

PDB Description: f9 pilus adhesin fmlh lectin domain from e. coli uti89 co-crystallized with tf antigen

PDB Compounds: (A:) Fml fimbrial adhesin FmlD

SCOPe Domain Sequences for d6aoxa_:

Sequence, based on SEQRES records:

>d6aoxa_ b.2.3.0 (A:) automated matches {Escherichia coli [TaxId: 364106]}
fscnvdggssigagttsvyvnldpviqpgqnlvvdlsqhiscwndyggwydtdhinlvqg
safagslqsykgslywnnvtypfplttntnvldigdktpmplplklyitpvgaaggvvik
ageviarihmykiatlgsgnprnftwniisnnsv

Sequence, based on observed residues (ATOM records):

>d6aoxa_ b.2.3.0 (A:) automated matches {Escherichia coli [TaxId: 364106]}
fscnvdggssigagttsvyvnldpviqpgqnlvvdlsqhiscwndyggwydtdhinlvqg
safagslqsykgslywnnvtypfplttntnvldigdktpmplplklyitvikageviari
hmykiatlgsgnprnftwniisnnsv

Timeline for d6aoxa_:

• d6aoxa_ first appeared in SCOPe 2.07