Lineage for d6aqub_ (6aqu B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2495627Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2495644Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2495645Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)
  6. 2495769Protein Purine nucleoside phosphorylase, PNP [53169] (14 species)
  7. 2495997Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [226822] (5 PDB entries)
  8. 2496008Domain d6aqub_: 6aqu B: [349366]
    automated match to d3phca_
    complexed with po4; mutant

Details for d6aqub_

PDB Entry: 6aqu (more details), 2.6 Å

PDB Description: crystal structure of plasmodium falciparum purine nucleoside phosphorylase: the m183l mutant
PDB Compounds: (B:) purine nucleoside phosphorylase

SCOPe Domain Sequences for d6aqub_:

Sequence, based on SEQRES records: (download)

>d6aqub_ c.56.2.1 (B:) Purine nucleoside phosphorylase, PNP {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
nllrhlkiskeqitpvvlvvgdpgrvdkikvvcdsyvdlaynreyksvechykgqkflcv
shgvgsagcavcfeelcqngakviiragscgslqpdlikrgdicicnaavredrvshlli
hgdfpavgdfdvydtlnkcaqelnvpvfngisvssdmyypnkiipsrledyskanaavve
lelatlmvigtlrkvktggilivdgcpfkwdegdfdnnlvphqlenmikialgacaklat
kya

Sequence, based on observed residues (ATOM records): (download)

>d6aqub_ c.56.2.1 (B:) Purine nucleoside phosphorylase, PNP {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
nllrhlkiskeqitpvvlvvgdpgrvdkikvvcdsyvdlaynreyksvechykgqkflcv
shgvgsagcavcfeelcqngakviiragscgslqpdlikrgdicicnaavredrvshlli
hgdfpavgdfdvydtlnkcaqelnvpvfngisvssdmpsrledyskanaavvelelatlm
vigtlrkvktggilivdgcpphqlenmikialgacaklatkya

SCOPe Domain Coordinates for d6aqub_:

Click to download the PDB-style file with coordinates for d6aqub_.
(The format of our PDB-style files is described here.)

Timeline for d6aqub_: