Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.1: Actin/HSP70 [53068] (8 proteins) |
Protein automated matches [226905] (13 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225574] (54 PDB entries) |
Domain d6b1ma1: 6b1m A:5-188 [349363] Other proteins in same PDB: d6b1ma3, d6b1mb3 automated match to d1atra1 complexed with anp, gol, mg; mutant |
PDB Entry: 6b1m (more details), 1.9 Å
SCOPe Domain Sequences for d6b1ma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6b1ma1 c.55.1.1 (A:5-188) automated matches {Human (Homo sapiens) [TaxId: 9606]} pavgidlgttyswvgvfqhgkveiiandqgnrttpsyvaftdterligdaaknqvamnpt ntvfdakrligrrfddavvqsdmkhwpfmvvndagrpkvqveykgetksfypeevssmvl tkmkeiaeaylgktvtnavvtvpayfndsqrqatkdagtiaglnvlriineptaaaiayg ldkk
Timeline for d6b1ma1: