Lineage for d5z0ua2 (5z0u A:123-554)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2829819Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 2830345Protein automated matches [190099] (31 species)
    not a true protein
  7. 2830532Species Thermoactinomyces vulgaris [TaxId:2026] [254920] (8 PDB entries)
  8. 2830533Domain d5z0ua2: 5z0u A:123-554 [349359]
    Other proteins in same PDB: d5z0ua1, d5z0ua3
    automated match to d1ji1a3
    complexed with ca, mpd; mutant

Details for d5z0ua2

PDB Entry: 5z0u (more details), 1.37 Å

PDB Description: thermoactinomyces vulgaris r-47 alpha-amylase i (tva i) 11 residues (from a363 to n373) deletion mutant (del11)
PDB Compounds: (A:) Neopullulanase 1

SCOPe Domain Sequences for d5z0ua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5z0ua2 c.1.8.1 (A:123-554) automated matches {Thermoactinomyces vulgaris [TaxId: 2026]}
nfktpdwlkngvmyqifpdrfyngdssndvqtgsytyngtptekkawgssvyadpgydns
lvffggdlagidqklgyikktlganilylnpifkaptnhkydtqdymavdpafgdnstlq
tlindihstangpkgylildgvfnhtgdshpwfdkynnfssqgayesqsspwynyytfyt
wpdsyasflgfnslpklnygnsgsavrgviynnsnsvaktylnppysvdgwrldaaqyvd
hqiwsefrnavkgvnsnaaiigeywgnanpwtaqgnqwdaatnfdgftqpvsewitgkdy
qnnsasisttqfdswlrgtranyptnvqqsmmnflsnhditrfatrsggdlwktylalif
qmtyvgtptiyygdeygmqggadpdnrrsfdwsqatpsnsavaltqklitirnqypalrt
g

SCOPe Domain Coordinates for d5z0ua2:

Click to download the PDB-style file with coordinates for d5z0ua2.
(The format of our PDB-style files is described here.)

Timeline for d5z0ua2: