SCOPe 2.07: Domain d5xzob_: 5xzo B:

Lineage for d5xzob_ (5xzo B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.0: automated matches [191314] (1 protein)
   not a true family

6. Protein automated matches [190075] (125 species)
   not a true protein

7. Species Bispora sp. [TaxId:554688] [349356] (2 PDB entries)

8. Domain d5xzob_: 5xzo B: [349357]
   automated match to d3u7ba_
   complexed with nag

Details for d5xzob_

PDB Entry: 5xzo, 1.5 Å

PDB Description: crystal structure of gh10 xylanase xyl10c from bispora. sp mey-1

PDB Compounds: (B:) Beta-xylanase

SCOPe Domain Sequences for d5xzob_:

Sequence; same for both SEQRES and ATOM records:

>d5xzob_ c.1.8.0 (B:) automated matches {Bispora sp. [TaxId: 554688]}
wglnnaaradgklwfgtaadipgleqddryymkeynnthdfggttpanimkfmftepeqn
vfnftgaqefldiafashklvrchnliwqselptwvtnpttnwtnetlskvlqnhvytlv
shfgdqcyswdvvnealsddpagsyqnniwfdtigpeyvamafeyaekavkdhklnvkly
yndynieypgpkstaaqnivkelkarniqidgvgleshfiagetpsqatqitnmadftsl
didvavteldvrlylppnatseaqqvadyyatvaacaatercigitvwdfddtyswvpst
fagqgyadlffqpdgpntplvkkaaydgclqal

Timeline for d5xzob_:

• d5xzob_ is new in SCOPe 2.07-stable
  
• d5xzob_ appears in the current release, SCOPe 2.08