Lineage for d5z0tb3 (5z0t B:555-637)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2810331Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2810332Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2810971Family b.71.1.0: automated matches [227134] (1 protein)
    not a true family
  6. 2810972Protein automated matches [226835] (41 species)
    not a true protein
  7. 2811194Species Thermoactinomyces vulgaris [TaxId:2026] [254921] (8 PDB entries)
  8. 2811197Domain d5z0tb3: 5z0t B:555-637 [349351]
    Other proteins in same PDB: d5z0ta1, d5z0ta2, d5z0tb1, d5z0tb2
    automated match to d1uh4a2
    complexed with ca, mpd; mutant

Details for d5z0tb3

PDB Entry: 5z0t (more details), 1.5 Å

PDB Description: thermoactinomyces vulgaris r-47 alpha-amylase i (tva i) mutant a357v/q359n/y360e (aqy/vne)
PDB Compounds: (B:) Neopullulanase 1

SCOPe Domain Sequences for d5z0tb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5z0tb3 b.71.1.0 (B:555-637) automated matches {Thermoactinomyces vulgaris [TaxId: 2026]}
sfmtlitddtnkiysygrfdnvnriavvlnndsvshtvnvpvwqlsmpngstvtdkitgh
sytvqngmvtvavdghygavlaq

SCOPe Domain Coordinates for d5z0tb3:

Click to download the PDB-style file with coordinates for d5z0tb3.
(The format of our PDB-style files is described here.)

Timeline for d5z0tb3: