| Class b: All beta proteins [48724] (180 folds) |
| Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) ![]() this domain is C-terminal to the catalytic beta/alpha barrel domain |
| Family b.71.1.0: automated matches [227134] (1 protein) not a true family |
| Protein automated matches [226835] (41 species) not a true protein |
| Species Thermoactinomyces vulgaris [TaxId:2026] [254921] (8 PDB entries) |
| Domain d5z0tb3: 5z0t B:555-637 [349351] Other proteins in same PDB: d5z0ta1, d5z0ta2, d5z0tb1, d5z0tb2 automated match to d1uh4a2 complexed with ca, mpd; mutant |
PDB Entry: 5z0t (more details), 1.5 Å
SCOPe Domain Sequences for d5z0tb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d5z0tb3 b.71.1.0 (B:555-637) automated matches {Thermoactinomyces vulgaris [TaxId: 2026]}
sfmtlitddtnkiysygrfdnvnriavvlnndsvshtvnvpvwqlsmpngstvtdkitgh
sytvqngmvtvavdghygavlaq
Timeline for d5z0tb3: