Lineage for d5z0tb2 (5z0t B:123-554)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2438500Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2438501Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 2439016Protein automated matches [190099] (33 species)
    not a true protein
  7. 2439216Species Thermoactinomyces vulgaris [TaxId:2026] [254920] (8 PDB entries)
  8. 2439219Domain d5z0tb2: 5z0t B:123-554 [349350]
    Other proteins in same PDB: d5z0ta1, d5z0ta3, d5z0tb1, d5z0tb3
    automated match to d1ji1a3
    complexed with ca, mpd; mutant

Details for d5z0tb2

PDB Entry: 5z0t (more details), 1.5 Å

PDB Description: thermoactinomyces vulgaris r-47 alpha-amylase i (tva i) mutant a357v/q359n/y360e (aqy/vne)
PDB Compounds: (B:) Neopullulanase 1

SCOPe Domain Sequences for d5z0tb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5z0tb2 c.1.8.1 (B:123-554) automated matches {Thermoactinomyces vulgaris [TaxId: 2026]}
nfktpdwlkngvmyqifpdrfyngdssndvqtgsytyngtptekkawgssvyadpgydns
lvffggdlagidqklgyikktlganilylnpifkaptnhkydtqdymavdpafgdnstlq
tlindihstangpkgylildgvfnhtgdshpwfdkynnfssqgayesqsspwynyytfyt
wpdsyasflgfnslpklnygnsgsavrgviynnsnsvaktylnppysvdgwrldvanevd
angnngsdvtnhqiwsefrnavkgvnsnaaiigeywgnanpwtaqgnqwdaatnfdgftq
pvsewitgkdyqnnsasisttqfdswlrgtranyptnvqqsmmnflsnhditrfatrsgg
dlwktylalifqmtyvgtptiyygdeygmqggadpdnrrsfdwsqatpsnsavaltqkli
tirnqypalrtg

SCOPe Domain Coordinates for d5z0tb2:

Click to download the PDB-style file with coordinates for d5z0tb2.
(The format of our PDB-style files is described here.)

Timeline for d5z0tb2: