Lineage for d1bx4a_ (1bx4 A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1618889Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 1618890Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 1618891Family c.72.1.1: Ribokinase-like [53614] (10 proteins)
    automatically mapped to Pfam PF00294
  6. 1618911Protein Adenosine kinase [53617] (2 species)
  7. 1618912Species Human (Homo sapiens) [TaxId:9606] [53618] (4 PDB entries)
  8. 1618913Domain d1bx4a_: 1bx4 A: [34935]
    complexed with adn, cl, mg

Details for d1bx4a_

PDB Entry: 1bx4 (more details), 1.5 Å

PDB Description: structure of human adenosine kinase at 1.50 angstroms
PDB Compounds: (A:) protein (adenosine kinase)

SCOPe Domain Sequences for d1bx4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bx4a_ c.72.1.1 (A:) Adenosine kinase {Human (Homo sapiens) [TaxId: 9606]}
vrenilfgmgnplldisavvdkdfldkyslkpndqilaedkhkelfdelvkkfkveyhag
gstqnsikvaqwmiqqphkaatffgcigidkfgeilkrkaaeahvdahyyeqneqptgtc
aacitgdnrslianlaaancykkekhldleknwmlvekarvcyiagffltvspesvlkva
hhasennriftlnlsapfisqfykeslmkvmpyvdilfgneteaatfareqgfetkdike
iakktqalpkmnskrqriviftqgrddtimatesevtafavldqdqkeiidtngagdafv
ggflsqlvsdkplteciraghyaasiiirrtgctfpekpdfh

SCOPe Domain Coordinates for d1bx4a_:

Click to download the PDB-style file with coordinates for d1bx4a_.
(The format of our PDB-style files is described here.)

Timeline for d1bx4a_: