Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (27 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
Protein automated matches [190226] (81 species) not a true protein |
Species Thermoactinomyces vulgaris [TaxId:2026] [254919] (8 PDB entries) |
Domain d5z0tb1: 5z0t B:1-122 [349349] Other proteins in same PDB: d5z0ta2, d5z0ta3, d5z0tb2, d5z0tb3 automated match to d1uh4a1 complexed with ca, mpd; mutant |
PDB Entry: 5z0t (more details), 1.5 Å
SCOPe Domain Sequences for d5z0tb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5z0tb1 b.1.18.0 (B:1-122) automated matches {Thermoactinomyces vulgaris [TaxId: 2026]} aandnnvewnglfhdqgplfdnapeptstqsvtlklrtfkgditsanikywdtadnafhw vpmvwdsndptgtfdywkgtipaspsikyyrfqindgtstawyngngpsstepnaddfyi ip
Timeline for d5z0tb1: