SCOPe 2.08: Domain d6ayza_: 6ayz A:

Lineage for d6ayza_ (6ayz A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.22: ASF1-like [101546] (2 families)
   contains extra C-terminal strand
   automatically mapped to Pfam PF04729

5. Family b.1.22.1: ASF1-like [101547] (2 proteins)

6. Protein automated matches [195145] (3 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [347659] (6 PDB entries)

8. Domain d6ayza_: 6ayz A: [349312]
   Other proteins in same PDB: d6ayzb_, d6ayzc1, d6ayzc2, d6ayzd1, d6ayzd2, d6ayzr_
   automated match to d2dzea_

Details for d6ayza_

PDB Entry: 6ayz, 2.1 Å

PDB Description: crystal structure of asf1-fab 12e complex

PDB Compounds: (A:) histone chaperone asf1

SCOPe Domain Sequences for d6ayza_:

Sequence, based on SEQRES records:

>d6ayza_ b.1.22.1 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
sivsllgikvlnnpakftdpyefeitfecleslkhdlewkltyvgssrsldhdqeldsil
vgpvpvgvnkfvfsadppsaelipaselvsvtvillscsydgrefvrvgyyvnneydeee
lrenppakvqvdhivrnilaekprvtrfnivwd

Sequence, based on observed residues (ATOM records):

>d6ayza_ b.1.22.1 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
sivsllgikvlnnpakftdpyefeitfeckhdlewkltyvgssrsldhdqeldsilvgpv
pvgvnkfvfsadppsaelipaselvsvtvillscsydgrefvrvgyyvnneydeeelren
ppakvqvdhivrnilaekprvtrfnivwd

Timeline for d6ayza_:

• d6ayza_ first appeared in SCOPe 2.07