Lineage for d6arka1 (6ark A:1-169)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2473887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2473888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2474875Family c.37.1.8: G proteins [52592] (80 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2476142Protein automated matches [190047] (34 species)
    not a true protein
  7. 2476240Species Human (Homo sapiens) [TaxId:9606] [186768] (286 PDB entries)
  8. 2476477Domain d6arka1: 6ark A:1-169 [349298]
    Other proteins in same PDB: d6arka2
    automated match to d4lyhb_
    complexed with bqd, gdp, gol, mg

Details for d6arka1

PDB Entry: 6ark (more details), 1.75 Å

PDB Description: crystal structure of compound 10 covalently bound to k-ras g12c
PDB Compounds: (A:) GTPase KRas

SCOPe Domain Sequences for d6arka1:

Sequence, based on SEQRES records: (download)

>d6arka1 c.37.1.8 (A:1-169) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgacgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetslldildtag
qeeysamrdqymrtgegfllvfainntksfedihhyreqikrvkdsedvpmvlvgnksdl
psrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhkek

Sequence, based on observed residues (ATOM records): (download)

>d6arka1 c.37.1.8 (A:1-169) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgacgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetslldildtag
qemrdqymrtgegfllvfainntksfedihhyreqikrvkdsedvpmvlvgnksdlpsrt
vdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhkek

SCOPe Domain Coordinates for d6arka1:

Click to download the PDB-style file with coordinates for d6arka1.
(The format of our PDB-style files is described here.)

Timeline for d6arka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6arka2