Lineage for d6azwb_ (6azw B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2351564Fold a.266: Indolic compounds 2,3-dioxygenase-like [140958] (1 superfamily)
    multihelical; bundle, contains interrupted helices
  4. 2351565Superfamily a.266.1: Indolic compounds 2,3-dioxygenase-like [140959] (3 families) (S)
    contains heme-dependent enzymes
  5. 2351575Family a.266.1.2: Indoleamine 2,3-dioxygenase-like [140963] (3 proteins)
    Pfam PF01231; contains extra N-terminal all-alpha subdomain of similar fold to the GST C-terminal domain (47615)
  6. 2351585Protein automated matches [190585] (2 species)
    not a true protein
  7. 2351586Species Human (Homo sapiens) [TaxId:9606] [187592] (47 PDB entries)
  8. 2351687Domain d6azwb_: 6azw B: [349285]
    automated match to d4u72b_
    complexed with c51

Details for d6azwb_

PDB Entry: 6azw (more details), 2.78 Å

PDB Description: ido1/fxb-001116 crystal structure
PDB Compounds: (B:) Indoleamine 2,3-dioxygenase 1

SCOPe Domain Sequences for d6azwb_:

Sequence, based on SEQRES records: (download)

>d6azwb_ a.266.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
miskeyhideevgfalpnpqenlpdfyndwmfiakhlpdliesgqlrerveklnmlsidh
ltdhksqrlarlvlgcitmayvwgkghgdvrkvlprniavpycqlskklelppilvyadc
vlanwkkkdpnkpltyenmdvlfsfrdgdcskgfflvsllveiaaasaikviptvfkamq
mqerdtllkalleiasclekalqvfhqihdhvnpkaffsvlriylsgwkgnpqlsdglvy
egfwedpkefaggsagqssvfqcfdvllgiqqtaggghaaqflqdmrrymppahrnflcs
lesnpsvrefvlskgdaglreaydacvkalvslrsyhlqivtkyilipasqqpkenktse
dpskleakgtggtdlmnflktvrstteksllk

Sequence, based on observed residues (ATOM records): (download)

>d6azwb_ a.266.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
miskeyhideevgfalpnpqenlpdfyndwmfiakhlpdliesgqlrerveklnmlsidh
ltdhksqrlarlvlgcitmayvwgkghgdvrkvlprniavpycqlskklelppilvyadc
vlanwkkkdpnkpltyenmdvlfsfrdgdcskgfflvsllveiaaasaikviptvfkamq
mqerdtllkalleiasclekalqvfhqihdhvnpkaffsvlriylsgwkgnpqlsdglvy
egfwedpkefaggsagqssvfqcfdvllgiqqtaggghaaqflqdmrrymppahrnflcs
lesnpsvrefvlskgdaglreaydacvkalvslrsyhlqivtkyilipasqqgtdlmnfl
ktvrstteksllk

SCOPe Domain Coordinates for d6azwb_:

Click to download the PDB-style file with coordinates for d6azwb_.
(The format of our PDB-style files is described here.)

Timeline for d6azwb_: