Lineage for d1ai9a_ (1ai9 A:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 707730Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 707731Superfamily c.71.1: Dihydrofolate reductase-like [53597] (2 families) (S)
  5. 707732Family c.71.1.1: Dihydrofolate reductases [53598] (3 proteins)
  6. 707842Protein Dihydrofolate reductases, eukaryotic type [53605] (4 species)
  7. 707897Species Yeast (Candida albicans) [TaxId:5476] [53609] (9 PDB entries)
  8. 707914Domain d1ai9a_: 1ai9 A: [34925]

Details for d1ai9a_

PDB Entry: 1ai9 (more details), 1.85 Å

PDB Description: candida albicans dihydrofolate reductase
PDB Compounds: (A:) dihydrofolate reductase

SCOP Domain Sequences for d1ai9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ai9a_ c.71.1.1 (A:) Dihydrofolate reductases, eukaryotic type {Yeast (Candida albicans) [TaxId: 5476]}
mlkpnvaiivaalkpalgigykgkmpwrlrkeiryfkdvttrttkpntrnavimgrktwe
sipqkfrplpdrlniilsrsyeneiiddniihassiesslnlvsdvervfiiggaeiyne
linnslvshlliteiehpspesiemdtflkfpleswtkqpkselqkfvgdtvleddikeg
dftynytlwtrk

SCOP Domain Coordinates for d1ai9a_:

Click to download the PDB-style file with coordinates for d1ai9a_.
(The format of our PDB-style files is described here.)

Timeline for d1ai9a_: