SCOPe 2.08: Domain d5w08p2: 5w08 P:110-212

Lineage for d5w08p2 (5w08 P:110-212)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d5w08p2: 5w08 P:110-212 [349235]
   Other proteins in same PDB: d5w08a_, d5w08b_, d5w08c_, d5w08d_, d5w08e_, d5w08f_, d5w08g_, d5w08h1, d5w08i_, d5w08j1, d5w08k_, d5w08l1, d5w08m_, d5w08n1, d5w08o_, d5w08p1, d5w08q_, d5w08r1
   automated match to d1mcol2
   complexed with gol, nag

Details for d5w08p2

PDB Entry: 5w08, 2.6 Å

PDB Description: a/texas/50/2012(h3n2) influenza hemagglutinin in complex with k03.12 fab

PDB Compounds: (P:) K03.12 antibody light chain

SCOPe Domain Sequences for d5w08p2:

Sequence; same for both SEQRES and ATOM records:

>d5w08p2 b.1.1.2 (P:110-212) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpkgapsvtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskq
snnkyaassylsltpeqwkshrsyscqvthegstvektvapte

Timeline for d5w08p2:

• d5w08p2 first appeared in SCOPe 2.07