| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (31 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
| Domain d5w08p1: 5w08 P:1-109 [349234] Other proteins in same PDB: d5w08a_, d5w08b_, d5w08c_, d5w08d_, d5w08e_, d5w08f_, d5w08h2, d5w08j2, d5w08l2, d5w08n2, d5w08p2, d5w08r2 automated match to d1mcda1 complexed with gol, nag |
PDB Entry: 5w08 (more details), 2.6 Å
SCOPe Domain Sequences for d5w08p1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5w08p1 b.1.1.0 (P:1-109) automated matches {Human (Homo sapiens) [TaxId: 9606]}
psaltqpasvsgspgqsvtisctgtnsdvgtfdlvswyqqypgkapkliiyegsrrpsgv
sdrfsgsksgntasltisglqaedeadyycssyagsvvfgggtkltvlg
Timeline for d5w08p1: