SCOPe 2.08: Domain d6auea1: 6aue A:14-133

Lineage for d6auea1 (6aue A:14-133)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)

6. Protein automated matches [190191] (2 species)
   not a true protein

7. Species Streptomyces avidinii [TaxId:1895] [189343] (100 PDB entries)

8. Domain d6auea1: 6aue A:14-133 [349219]
   Other proteins in same PDB: d6auea2
   automated match to d2bc3b_
   complexed with ol3

Details for d6auea1

PDB Entry: 6aue, 1.36 Å

PDB Description: artificial metalloproteins containing a co4o4 active site - 2xm-s112y- b

PDB Compounds: (A:) streptavidin

SCOPe Domain Sequences for d6auea1:

Sequence; same for both SEQRES and ATOM records:

>d6auea1 b.61.1.1 (A:14-133) automated matches {Streptomyces avidinii [TaxId: 1895]}
eagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtal
gwtvawknnyrnahsattwsgqyvggaqarintqwlltygtteanawastlvghdtftkv

Timeline for d6auea1:

• d6auea1 first appeared in SCOPe 2.07