Lineage for d5z3rh_ (5z3r H:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935697Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2936287Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2936379Family d.17.4.3: Ketosteroid isomerase-like [54434] (3 proteins)
    automatically mapped to Pfam PF12680
    automatically mapped to Pfam PF02136
  6. 2936380Protein Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI [54435] (3 species)
  7. 2936453Species Mycobacterium neoaurum [TaxId:1795] [419784] (1 PDB entry)
  8. 2936461Domain d5z3rh_: 5z3r H: [349189]
    automated match to d2z7ac_

Details for d5z3rh_

PDB Entry: 5z3r (more details), 2.42 Å

PDB Description: crystal structure of delta 5-3-ketosteroid isomerase from mycobacterium sp.
PDB Compounds: (H:) steroid delta-isomerase

SCOPe Domain Sequences for d5z3rh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5z3rh_ d.17.4.3 (H:) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Mycobacterium neoaurum [TaxId: 1795]}
vspvvaasqnswrcvqsgdregwlalmaddivvedpigeavtnpdgtgvrgkaalaafyd
tnigpnrlrvtceatfpssspteiayilvlettfpngfvatvrgvftyrvddaglitnlr
gywnmdamtft

SCOPe Domain Coordinates for d5z3rh_:

Click to download the PDB-style file with coordinates for d5z3rh_.
(The format of our PDB-style files is described here.)

Timeline for d5z3rh_: