Lineage for d2cd2a_ (2cd2 A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 26980Fold c.71: Dihydrofolate reductases [53596] (1 superfamily)
  4. 26981Superfamily c.71.1: Dihydrofolate reductases [53597] (1 family) (S)
  5. 26982Family c.71.1.1: Dihydrofolate reductases [53598] (3 proteins)
  6. 27067Protein Dihydrofolate reductases, eukaryotic type [53605] (4 species)
  7. 27077Species Fungus (Pneumocystis carinii) [TaxId:4754] [53608] (7 PDB entries)
  8. 27079Domain d2cd2a_: 2cd2 A: [34918]

Details for d2cd2a_

PDB Entry: 2cd2 (more details), 1.9 Å

PDB Description: ligand induced conformational changes in the crystal structures of pneumocystis carinii dihydrofolate reductase complexes with folate and nadp+

SCOP Domain Sequences for d2cd2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cd2a_ c.71.1.1 (A:) Dihydrofolate reductases, eukaryotic type {Fungus (Pneumocystis carinii)}
mnqqksltlivalttsygigrsnslpwklkkeisyfkrvtsfvptfdsfesmnvvlmgrk
twesiplqfrplkgrinvvitrnesldlgngihsaksldhalellyrtygsessvqinri
fviggaqlykaamdhpkldrimatiiykdihcdvffplkfrdkewssvwkkekhsdlesw
vgtkvphgkinedgfdyefemwtrdl

SCOP Domain Coordinates for d2cd2a_:

Click to download the PDB-style file with coordinates for d2cd2a_.
(The format of our PDB-style files is described here.)

Timeline for d2cd2a_: