SCOPe 2.06: Domain d1dyra_: 1dyr A:

Lineage for d1dyra_ (1dyr A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)

6. Protein Dihydrofolate reductases, eukaryotic type [53605] (7 species)

7. Species Fungus (Pneumocystis carinii) [TaxId:4754] [53608] (25 PDB entries)

8. Domain d1dyra_: 1dyr A: [34916]
   complexed with ndp, top

Details for d1dyra_

PDB Entry: 1dyr, 1.86 Å

PDB Description: the structure of pneumocystis carinii dihydrofolate reductase to 1.9 angstroms resolution

PDB Compounds: (A:) dihydrofolate reductase

SCOPe Domain Sequences for d1dyra_:

Sequence; same for both SEQRES and ATOM records:

>d1dyra_ c.71.1.1 (A:) Dihydrofolate reductases, eukaryotic type {Fungus (Pneumocystis carinii) [TaxId: 4754]}
nqqksltlivalttsygigrsnslpwklkkeisyfkrvtsfvptfdsfesmnvvlmgrkt
wesiplqfrplkgrinvvitrnesldlgngihsaksldhalellyrtygsessvqinrif
viggaqlykaamdhpkldrimatiiykdihcdvffplkfrdkewssvwkkekhsdleswv
gtkvphgkinedgfdyefemwtrdl

Timeline for d1dyra_:

• d1dyra_ first appeared (with stable ids) in SCOP 1.55, called d1dyr__
  
• d1dyra_ appears in SCOPe 2.05
  
• d1dyra_ appears in SCOPe 2.07
  
• d1dyra_ appears in the current release, SCOPe 2.08