Lineage for d6aodc_ (6aod C:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2387558Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2387559Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2387819Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2388211Protein Coagulation factor XI [117237] (1 species)
  7. 2388212Species Human (Homo sapiens) [TaxId:9606] [117238] (49 PDB entries)
    Uniprot P03951 388-624
  8. 3049090Domain d6aodc_: 6aod C: [349152]
    Other proteins in same PDB: d6aoda1, d6aoda2
    automated match to d5exna_
    complexed with co, gol, po4, so4

Details for d6aodc_

PDB Entry: 6aod (more details), 1.8 Å

PDB Description: fxia antibody complex
PDB Compounds: (C:) Coagulation factor XI

SCOPe Domain Sequences for d6aodc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6aodc_ b.47.1.2 (C:) Coagulation factor XI {Human (Homo sapiens) [TaxId: 9606]}
ivggtasvrgewpwqvtlhttsptqrhlcggsiignqwiltaahcfygvespkilrvysg
ilqqseikedtsffgvqeiiihdqykmaesgydiallklettvqytdsqrpislpskgdr
nviytdcwvtgwgyrklrdkiqntlqkakiplvtneecqkryrghkithkmicagyregg
kdackgdaggplsckhnevwhlvgitswgegcaqrerpgvytnvveyvdwilektq

SCOPe Domain Coordinates for d6aodc_:

Click to download the PDB-style file with coordinates for d6aodc_.
(The format of our PDB-style files is described here.)

Timeline for d6aodc_: