Lineage for d6arxb_ (6arx B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2899459Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2899460Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2901917Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2901918Protein automated matches [190543] (131 species)
    not a true protein
  7. 2901928Species African malaria mosquito (Anopheles gambiae) [TaxId:7165] [348788] (3 PDB entries)
  8. 2901932Domain d6arxb_: 6arx B: [349151]
    automated match to d1maac_
    complexed with cl, flc, nag; mutant

Details for d6arxb_

PDB Entry: 6arx (more details), 2.3 Å

PDB Description: crystal structure of an insecticide-resistant acetylcholinesterase mutant from the malaria vector anopheles gambiae in the ligand-free state
PDB Compounds: (B:) acetylcholinesterase

SCOPe Domain Sequences for d6arxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6arxb_ c.69.1.0 (B:) automated matches {African malaria mosquito (Anopheles gambiae) [TaxId: 7165]}
ndplvvntdkgrirgitvdapsgkkvdvwlgipyaqppvgplrfrhprpaekwtgvlntt
tppnscvqivdtvfgdfpgatmwnpntplsedclyinvvaprprpknaavmlwifggsfy
sgtatldvydhralaseenvivvslqyrvaslgflflgtpeapgnaglfdqnlalrwvrd
nihrfggdpsrvtlfgesagavsvslhllsalsrdlfqrailqsgsptapwalvsreeat
lralrlaeavgcphepsklsdaveclrgkdphvlvnnewgtlgicefpfvpvvdgaflde
tpqrslasgrfkkteiltgsnteegyyfiiyyltellrkeegvtvtreeflqavrelnpy
vngaarqaivfeytdwtepdnpnsnrdaldkmvgdyhftcnvnefaqryaeegnnvymyl
ythrskgnpwprwtgvmhgdeinyvfgeplnptlgytedekdfsrkimrywsnfaktgnp
npntassefpewpkhtahgrhylelglntsfvgrgprlrqcafwkkylpqlvaatsn

SCOPe Domain Coordinates for d6arxb_:

Click to download the PDB-style file with coordinates for d6arxb_.
(The format of our PDB-style files is described here.)

Timeline for d6arxb_: