![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
![]() | Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) ![]() this domain is C-terminal to the catalytic beta/alpha barrel domain |
![]() | Family b.71.1.0: automated matches [227134] (1 protein) not a true family |
![]() | Protein automated matches [226835] (41 species) not a true protein |
![]() | Species Thermoactinomyces vulgaris [TaxId:2026] [254921] (8 PDB entries) |
![]() | Domain d5z0ta3: 5z0t A:555-637 [349130] Other proteins in same PDB: d5z0ta1, d5z0ta2, d5z0tb1, d5z0tb2 automated match to d1uh4a2 complexed with ca, mpd; mutant |
PDB Entry: 5z0t (more details), 1.5 Å
SCOPe Domain Sequences for d5z0ta3:
Sequence; same for both SEQRES and ATOM records: (download)
>d5z0ta3 b.71.1.0 (A:555-637) automated matches {Thermoactinomyces vulgaris [TaxId: 2026]} sfmtlitddtnkiysygrfdnvnriavvlnndsvshtvnvpvwqlsmpngstvtdkitgh sytvqngmvtvavdghygavlaq
Timeline for d5z0ta3: