Lineage for d5z0ta1 (5z0t A:1-122)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2766140Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2766141Protein automated matches [190226] (81 species)
    not a true protein
  7. 2766547Species Thermoactinomyces vulgaris [TaxId:2026] [254919] (8 PDB entries)
  8. 2766549Domain d5z0ta1: 5z0t A:1-122 [349128]
    Other proteins in same PDB: d5z0ta2, d5z0ta3, d5z0tb2, d5z0tb3
    automated match to d1uh4a1
    complexed with ca, mpd; mutant

Details for d5z0ta1

PDB Entry: 5z0t (more details), 1.5 Å

PDB Description: thermoactinomyces vulgaris r-47 alpha-amylase i (tva i) mutant a357v/q359n/y360e (aqy/vne)
PDB Compounds: (A:) Neopullulanase 1

SCOPe Domain Sequences for d5z0ta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5z0ta1 b.1.18.0 (A:1-122) automated matches {Thermoactinomyces vulgaris [TaxId: 2026]}
aandnnvewnglfhdqgplfdnapeptstqsvtlklrtfkgditsanikywdtadnafhw
vpmvwdsndptgtfdywkgtipaspsikyyrfqindgtstawyngngpsstepnaddfyi
ip

SCOPe Domain Coordinates for d5z0ta1:

Click to download the PDB-style file with coordinates for d5z0ta1.
(The format of our PDB-style files is described here.)

Timeline for d5z0ta1: