| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.4: I set domains [49159] (39 proteins) |
| Protein Fc gamma receptor ectodomain (CD32) [49196] (3 species) possibly an intermediate structure between the I set and FnIII domains |
| Species Human (Homo sapiens), III [TaxId:9606] [49199] (11 PDB entries) Uniprot O75015 23-189 |
| Domain d5yc5c2: 5yc5 C:87-174 [349127] Other proteins in same PDB: d5yc5a1, d5yc5a2, d5yc5b1, d5yc5b2 automated match to d1fnla2 complexed with cl |
PDB Entry: 5yc5 (more details), 2.71 Å
SCOPe Domain Sequences for d5yc5c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5yc5c2 b.1.1.4 (C:87-174) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]}
higwlllqaprwefkegdpihlrchswkntalhkvtylqngkgrkyfhhnsdfyipkatl
kdsgsyscrglvgsknvssetvnititq
Timeline for d5yc5c2:
View in 3DDomains from other chains: (mouse over for more information) d5yc5a1, d5yc5a2, d5yc5b1, d5yc5b2 |