SCOPe 2.08: Domain d6aoyb_: 6aoy B:

Lineage for d6aoyb_ (6aoy B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.3: Bacterial adhesins [49401] (7 families)

5. Family b.2.3.0: automated matches [191391] (1 protein)
   not a true family

6. Protein automated matches [190503] (10 species)
   not a true protein

7. Species Escherichia coli [TaxId:364106] [349115] (10 PDB entries)

8. Domain d6aoyb_: 6aoy B: [349123]
   automated match to d4xocb_
   complexed with 145, so4

Details for d6aoyb_

PDB Entry: 6aoy, 1.8 Å

PDB Description: f9 pilus adhesin fmlh lectin domain from e. coli uti89 co-crystallized with o-nitrophenyl beta-galactoside (onpg)

PDB Compounds: (B:) Fml fimbrial adhesin FmlD

SCOPe Domain Sequences for d6aoyb_:

Sequence; same for both SEQRES and ATOM records:

>d6aoyb_ b.2.3.0 (B:) automated matches {Escherichia coli [TaxId: 364106]}
fscnvdggssigagttsvyvnldpviqpgqnlvvdlsqhiscwndyggwydtdhinlvqg
safagslqsykgslywnnvtypfplttntnvldigdktpmplplklyitpvgaaggvvik
ageviarihmykiatlgsgnprnftwniisnnsvvmp

Timeline for d6aoyb_:

• d6aoyb_ first appeared in SCOPe 2.07