![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies) sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold |
![]() | Superfamily b.2.3: Bacterial adhesins [49401] (7 families) ![]() |
![]() | Family b.2.3.0: automated matches [191391] (1 protein) not a true family |
![]() | Protein automated matches [190503] (10 species) not a true protein |
![]() | Species Escherichia coli [TaxId:364106] [349115] (10 PDB entries) |
![]() | Domain d6arma_: 6arm A: [349121] automated match to d4xocb_ complexed with 145, so4 |
PDB Entry: 6arm (more details), 1.5 Å
SCOPe Domain Sequences for d6arma_:
Sequence, based on SEQRES records: (download)
>d6arma_ b.2.3.0 (A:) automated matches {Escherichia coli [TaxId: 364106]} fscnvdggssigagttsvyvnldpviqpgqnlvvdlsqhiscwndyggwydtdhinlvqg safagslqsykgslywnnvtypfplttntnvldigdktpmplplklyitpvgaaggvvik ageviarihmykiatlgsgnprnftwniisnnsvvm
>d6arma_ b.2.3.0 (A:) automated matches {Escherichia coli [TaxId: 364106]} fscnvdggssigagttsvyvnldpviqpgqnlvvdlsqhiscwndyggwydtdhinlvqg safagslqsykgslywnnvtypfplttntnvldigdktpmplplklyitpgvvikagevi arihmykiatlgsgnprnftwniisnnsvvm
Timeline for d6arma_: