SCOPe 2.08: Domain d6aowa_: 6aow A:

Lineage for d6aowa_ (6aow A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.3: Bacterial adhesins [49401] (7 families)

5. Family b.2.3.0: automated matches [191391] (1 protein)
   not a true family

6. Protein automated matches [190503] (10 species)
   not a true protein

7. Species Escherichia coli [TaxId:364106] [349115] (10 PDB entries)

8. Domain d6aowa_: 6aow A: [349116]
   automated match to d4xocb_
   complexed with so4

Details for d6aowa_

PDB Entry: 6aow, 1.6 Å

PDB Description: crystal structure of lectin domain of f9 pilus adhesin fmlh from e. coli uti89

PDB Compounds: (A:) F9 pilus adhesin FmlH

SCOPe Domain Sequences for d6aowa_:

Sequence, based on SEQRES records:

>d6aowa_ b.2.3.0 (A:) automated matches {Escherichia coli [TaxId: 364106]}
fscnvdggssigagttsvyvnldpviqpgqnlvvdlsqhiscwndyggwydtdhinlvqg
safagslqsykgslywnnvtypfplttntnvldigdktpmplplklyitpvgaaggvvik
ageviarihmykiatlgsgnprnftwniisnnsvvmp

Sequence, based on observed residues (ATOM records):

>d6aowa_ b.2.3.0 (A:) automated matches {Escherichia coli [TaxId: 364106]}
fscnvdggssigagttsvyvnldpviqpgqnlvvdlsqhiscwndyggwydtdhinlvqg
safagslqsykgslywnnvtypfplttntnvldigdktpmplplklyitpgvvikagevi
arihmykiatlgsgnprnftwniisnnsvvmp

Timeline for d6aowa_:

• d6aowa_ first appeared in SCOPe 2.07