SCOPe 2.08: Domain d5xwdd1: 5xwd D:2-96

Lineage for d5xwdd1 (5xwd D:2-96)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d5xwdd1: 5xwd D:2-96 [349090]
   Other proteins in same PDB: d5xwdd2, d5xwdh2
   automated match to d2ybrh_
   complexed with nag, zn

Details for d5xwdd1

PDB Entry: 5xwd, 2.89 Å

PDB Description: crystal structure of the complex of 059-152-fv and egfr-ecd

PDB Compounds: (D:) VL chain of 059-152

SCOPe Domain Sequences for d5xwdd1:

Sequence; same for both SEQRES and ATOM records:

>d5xwdd1 b.1.1.0 (D:2-96) automated matches {Human (Homo sapiens) [TaxId: 9606]}
syvltqppsvsvapgktaritcggnnigsksvhwyqqkpgqapvlviyydsdrpsgiper
fsgsnsgntatltisrveagdeadyycqvwdsssd

Timeline for d5xwdd1:

• d5xwdd1 first appeared in SCOPe 2.07