Lineage for d1dlr__ (1dlr -)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 74023Fold c.71: Dihydrofolate reductases [53596] (1 superfamily)
  4. 74024Superfamily c.71.1: Dihydrofolate reductases [53597] (1 family) (S)
  5. 74025Family c.71.1.1: Dihydrofolate reductases [53598] (3 proteins)
  6. 74110Protein Dihydrofolate reductases, eukaryotic type [53605] (4 species)
  7. 74129Species Human (Homo sapiens) [TaxId:9606] [53607] (11 PDB entries)
  8. 74136Domain d1dlr__: 1dlr - [34909]

Details for d1dlr__

PDB Entry: 1dlr (more details), 2.3 Å

PDB Description: methotrexate-resistant variants of human dihydrofolate reductase with substitution of leucine 22: kinetics, crystallography and potential as selectable markers

SCOP Domain Sequences for d1dlr__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dlr__ c.71.1.1 (-) Dihydrofolate reductases, eukaryotic type {Human (Homo sapiens)}
vgslncivavsqnmgigkngdfpwpplrnefryfqrmtttssvegkqnlvimgkktwfsi
peknrplkgrinlvlsrelkeppqgahflsrslddalklteqpelankvdmvwivggssv
ykeamnhpghlklfvtrimqdfesdtffpeidlekykllpeypgvlsdvqeekgikykfe
vyeknd

SCOP Domain Coordinates for d1dlr__:

Click to download the PDB-style file with coordinates for d1dlr__.
(The format of our PDB-style files is described here.)

Timeline for d1dlr__: