SCOPe 2.08: Domain d5yc5b2: 5yc5 B:340-444

Lineage for d5yc5b2 (5yc5 B:340-444)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d5yc5b2: 5yc5 B:340-444 [349086]
   Other proteins in same PDB: d5yc5c1, d5yc5c2
   automated match to d1hzhh4
   complexed with cl

Details for d5yc5b2

PDB Entry: 5yc5, 2.71 Å

PDB Description: crystal structure of human igg-fc in complex with aglycan and optimized fc gamma receptor iiia

PDB Compounds: (B:) Immunoglobulin gamma-1 heavy chain

SCOPe Domain Sequences for d5yc5b2:

Sequence; same for both SEQRES and ATOM records:

>d5yc5b2 b.1.1.2 (B:340-444) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kgqprepqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvld
sdgsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslsls

Timeline for d5yc5b2:

• d5yc5b2 first appeared in SCOPe 2.07