SCOPe 2.07: Domain d6ap6a_: 6ap6 A:

Lineage for d6ap6a_ (6ap6 A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (124 species)
   not a true protein

7. Species Petunia hybrida [TaxId:4102] [256236] (7 PDB entries)

8. Domain d6ap6a_: 6ap6 A: [349084]
   automated match to d4dnqi_
   complexed with tlf

Details for d6ap6a_

PDB Entry: 6ap6, 1.65 Å

PDB Description: crystal structure of dad2 in complex with tolfenamic acid

PDB Compounds: (A:) Probable strigolactone esterase DAD2

SCOPe Domain Sequences for d6ap6a_:

Sequence; same for both SEQRES and ATOM records:

>d6ap6a_ c.69.1.0 (A:) automated matches {Petunia hybrida [TaxId: 4102]}
qtlldalnvrvvgsgervlvlahgfgtdqsawnrilpfflrdyrvvlydlvcagsvnpdf
fdfrryttldpyvddllhildalgidqcayvghsvsamigilasirrpelfskliligas
prflndedyhggfeqgeiekvfsameanyeawvngfaplavgadvpaavrefsrtlfnmr
pditlfvsrtvfnsdmrgvlglvkvpchifqtardhsvpasvatylknhlggkntvhwln
ieghlphlsaptllaqelrralsh

Timeline for d6ap6a_:

• d6ap6a_ is new in SCOPe 2.07-stable
  
• d6ap6a_ appears in the current release, SCOPe 2.08